Recombinant staphylococcus aureus PVL F protein (Active) (ab230258)

Description

  • Product name

    Recombinant staphylococcus aureus PVL F protein (Active)
  • Biological activity

    PVL Cytotoxicity assay: Cytotoxicity can be detected in human neutrophils when used in combination with LukS-PV in a concentration range of 1-100 nM.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      AQHITPVSEKKVDDKITLYKTTATSDSDKLKISQILTFNFIKDKSYDKDT LILKAAGNIYSGYTKPNPKDTISSQFYWGSKYNISINSDSNDSVNVVDYA PKNQNEEFQVQQTVGYSYGGDINISNGLSGGGNGSKSFSETINYKQESYR TSLDKRTNFKKIGWDVEAHKIMNNGWGPYGRDSYHSTYGNEMFLGSRQSN LNAGQNFLEYHKMPVLSRGNFNPEFIGVLSRKQNAAKKSKITVTYQREMD RYTNFWNQLHWIGNNYKDENRATHTS
    • Predicted molecular weight

      36 kDa
    • Amino acids

      25 to 325
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 325. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab230258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: PBS, 5% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • LukF-PV
    • Panton-Valentine Leukocidin F subunit
    • PVL F subunit

Images

  • SDS-PAGE analysis of 1 µg (lane 1) and 5 µg (lane 2) ab230258.

  • Anti-PVL F polyclonal antibody at 0.5 µg/ml + Recombinant staphylococcus aureus PVL F protein (Active) (ab230258) at 0.1 µg

    Secondary
    Anti-rabbit IgG-HRP conjugate


    Followed by TMB substrate.

  • Human promyelocytic leukemia cell line HL60 was differentiated into neutrophils by treatment with DMSO. Neutrophils were incubated with serial dilutions of ab230258 and LukS-PV at equimolar concentration for 3 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubating for additional 16 hours. Cells were centrifuged and the OD determined in the supernatants at 470/690 nm.  EC50 values were found to be 0.907 nM.

References

ab230258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up