Recombinant Staphylococcus aureus Staphylococcus Enterotoxin G protein (His tag) (ab225609)

Description

  • Product name

    Recombinant Staphylococcus aureus Staphylococcus Enterotoxin G protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDL IFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDI NQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVT IQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKE LVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      26 to 258
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain N315. This product is the full-length mature protein from aa 26 to 258 with a 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Enterotoxin type G
    • entG
    • SEG
  • Relevance

    Staphylococcal enterotoxins represent a group of proteins which are secreted by Staphylococcus aureus and cause the intoxication staphylococcal food poisoning syndrome. The illness is characterised by high fever, hypotension, diarrhea, shock and, in some cases, death.
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225609 with 5% enrichment gel and 15% separation gel.

References

ab225609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up