Recombinant Staphylococcus aureus Staphylococcus Enterotoxin H protein (His tag) (ab241533)

Description

  • Product name

    Recombinant Staphylococcus aureus Staphylococcus Enterotoxin H protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSG NDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLN SEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKY KIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLK SDDISHIDVNLYTKKKV
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      25 to 241
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab241533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Enterotoxin H
    • Enterotoxin type H
    • EntH
    • SEH
    • Staphylococcus enterotoxin H
    • Staphylococcus enterotoxin type H
    see all
  • Relevance

    Staphylococcus enterotoxin H (SEH) belongs to the staphylococcal enterotoxin (SE) family of superantigens (SAgs). SEH has structural similarities to other SE; however, its biological properties are less well characterized. SEH binds with high affinity to human major histocompatibility complex (MHC) class II and exhibits strong mitogenic activity in human T cells.
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241533.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab241533 could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus Enterotoxin H protein.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab241533 could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus Enterotoxin H protein.

References

ab241533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up