Description

  • Product name

    Recombinant Staphylococcus Enterotoxin E protein (Tagged)
    See all Staphylococcus Enterotoxin E proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      SEEINEKDLRKKSELQRNALSNLRQIYYYNEKAITENKESDDQFLENTLL FKGFFTGHPWYNDLLVDLGSKDATNKYKGKKVDLYGAYYGYQCAGGTPNK TACMYGGVTLHDNNRLTEEKKVPINLWIDGKQTTVPIDKVKTSKKEVTVQ ELDLQARHYLHGKFGLYNSDSFGGKVQRGLIVFHSSEGSTVSYDLFDAQG QYPDTLLRIYRDNKTINSENLHIDLYLYTT
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      28 to 257
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full-length Staphylococcus aureus mature chain lacking the signal peptide. N-terminal 6xHis-SUMO-tagged

Specifications

Our Abpromise guarantee covers the use of ab235850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • EntE
    • Enterotoxin type E
    • SEE
    • Staphylococcus enterotoxin E
    • Staphylococcus enterotoxin type E
    see all
  • Relevance

    Staphylococcal enterotoxins represent a group of proteins, which are secreted by Staphylococcus aureus and cause the intoxication staphylococcal food poisoning syndrome. The illness is characterised by high fever, hypotension, diarrhea, shock, and in some cases death. Their molecular masses range between 27 and 30 kDa. At present, seven enterotoxins are known, namely A, B, C1, C2, C3, D and E. Their amino acid sequences have been determined and it was shown that all are single chain polypeptides containing one disulfide bond formed by two half cystines located in the middle of the polypeptide chain, which form the so called cysteine loop. Enterotoxins are known to be most potent T cell mitogens. T cell activation accompanied by induction of interleukin 2 and interferon is conditioned by high affinity interaction of S.enterotoxins with class II main histocompatibility complex (MHC) molecules and subsequent presentation of the complex formed to a variable region of the T cell receptor.
  • Cellular localization

    Secreted

Images

  • ab235850 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up