Description

  • Product name

    Recombinant Streptavidin protein
    See all Streptavidin proteins and peptides
  • Biological activity

    Activity: > 17U / mg (one unit = streptavidin binds 1 μg D-biotin at pH 8.9).

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Streptomyces avidinii
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFDPSKDSKAQVSAAEAGITGTW YNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGT ALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWK STLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      1 to 183
    • Additional sequence information

      Expressed with a small T7-His-TEV cleavage site Tag (29 aa) fusion at its N-terminal

Specifications

Our Abpromise guarantee covers the use of ab216251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab216251 can be used for assaying biotin conjugated targets, such as protein, small molecular and others in various detection technologies

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, sucrose and DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • SA V1
    • SA V2
    • strepavidin
    • Streptavidin V1
    • Streptavidin V2
    see all
  • Relevance

    Streptavidin is a tetrameric protein purified from Streptomyces sp. that binds very tightly to the vitamin biotin with a Kd of ~ 10-14 mol/l. The high affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits.
  • Cellular localization

    Cytoplasmic

References

ab216251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up