Description

  • Product name

    Recombinant Turkey IGF1 protein
    See all IGF1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab208970 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Turkey
    • Sequence

      GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQ SCDLRRLEMYCAPIKPPKSA
    • Predicted molecular weight

      8 kDa
    • Amino acids

      49 to 118
    • Additional sequence information

      Turkey

Specifications

Our Abpromise guarantee covers the use of ab208970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab208970 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile Phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • IBP1
    • IGF I
    • IGF IA
    • IGF IB
    • IGF-I
    • Igf1
    • IGF1_HUMAN
    • IGF1A
    • IGFI
    • IGFIA
    • Insulin like growth factor 1
    • Insulin like growth factor 1 (somatomedin C)
    • Insulin like growth factor IA
    • Insulin like growth factor IB
    • Insulin-like growth factor I
    • Mechano growth factor
    • MGF
    • OTTHUMP00000195080
    • OTTHUMP00000195081
    • OTTHUMP00000195082
    • OTTHUMP00000195083
    • OTTHUMP00000195084
    • Somatomedia C
    • Somatomedin C
    • Somatomedin-C
    see all
  • Function

    The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake.
  • Involvement in disease

    Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation.
  • Sequence similarities

    Belongs to the insulin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab208970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up