Recombinant vacA protein (His tag) (ab225655)

Overview

  • Product name

    Recombinant vacA protein (His tag)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Helicobacter pylori
    • Sequence

      TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQA GKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDM KDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTT RVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEI SLYDGATLN
    • Molecular weight

      27 kDa including tags
    • Amino acids

      37 to 245
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab225655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • vacA
    • HP_0887
    • Vacuolating cytotoxin
    • Vacuolating cytotoxin autotransporter
    • Vacuolating cytotoxin translocator
    see all
  • Relevance

    Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.
  • Cellular localization

    Cell Membrane and Secreted

Images

  • Discontinuous SDS-PAGE(Tris-Glycine gel) (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225655 could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) vacA.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225655 could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) vacA.

References

ab225655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up