Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Vaccinia virus
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFELHSYAIDIENEITEFFNKMR DTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDY VVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDC VQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKD NKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSR CKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEW ENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNY YFEKTLTTTVVLE
    • Molecular weight

      22 kDa including tags
    • Amino acids

      20 to 351
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      B18R cDNA was constructed with 31 N terminal T7/His tag from Vaccinia Virus.

Specifications

Our Abpromise guarantee covers the use of ab190383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by neutralization of IFN-alpha effects on MCF7 cells in RT-PCR assay using IFN-alpha specific induced target gene index.

     

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µl
  • Purity

    > 95 % SDS-PAGE.
    The final product was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

References

ab190383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up