Description

  • Product name

    Recombinant vaccinia virus B18R protein (Active)
    See all B18R proteins and peptides
  • Biological activity

    Immobilized Human IFN-α1a at 2μg/mL (100 µL/well), can bind ab219894 with a linear range of 0.8-10 ng/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Vaccinia virus
    • Sequence

      HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPF SAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYT SKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGID LYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRY DCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPAN ITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYF ENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      20 to 351
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide from Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR).

Specifications

Our Abpromise guarantee covers the use of ab219894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml.

Images

  • SDS-PAGE analysis of reduced ab219894 stained overnight with Coomassie Blue.

  • Immobilized Human IFN-α1a at 2μg/mL (100 µL/well), can bind ab219894 with a linear range of 0.8-10 ng/mL.

References

ab219894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up