Description

  • Product name

    Recombinant VCAM1 (mouse)
    See all VCAM1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      FKIEISPEYKTIAQIGDSMALTCSTTGCESPLFSWRTQIDSPLNAKVRTE GSKSVLTMEPVSFENEHSYLCTATCGSGKLERSIHVDIYSFPKDPEIQFS GPLEVGKPVTVKCLAPDIYPVYRLEIDLFKGDQLMNRQEFSSEEMTKSLE TKSLEVTFTPVIEDIGKALVCRAKLHIDQIDSTLKERETVKELQVYISPR NTTISVHPSTRLQEGGAVTMTCSSEGLPAPEIFWGRKLDNEVLQLLSGNA TLTLIAMRMEDSGVYVCEGVNLIGRDKAEVELVVQ
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      25 to 309

Specifications

Our Abpromise guarantee covers the use of ab205903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Sandwich ELISA

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.29% Sodium chloride, 0.01% EDTA, 0.61% Tris, 1% Glycine, 8.7% DL-Arginine, 0.1% Glutathione, 10% Glycerol

General Info

  • Alternative names

    • CD106
    • CD106 Antigen
    • INCAM 100
    • INCAM-100
    • L1CAM
    • MGC99561
    • V-CAM 1
    • Vascular Cell Adhesion Molecule 1
    • Vascular cell adhesion protein 1
    • VCAM 1
    • VCAM-1
    • VCAM1
    • VCAM1_HUMAN
    see all
  • Function

    Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
  • Tissue specificity

    Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue.
  • Sequence similarities

    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Either the first or the fourth Ig-like C2-type domain is required for VLA4-dependent cell adhesion.
  • Post-translational
    modifications

    Sialoglycoprotein.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab205903 (1μg) stained with colloidal coomassie blue.

References

ab205903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up