Description

  • Product name

    Recombinant Verotoxin 2 beta protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVT IKSSTCESGSGFAEVQFNND
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      20 to 89
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Enterobacteria phage 933W (Bacteriophage 933W). N-terminal 6xHis-SUMO-tagged. Full-length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab236926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Shiga like toxin II subunit B
    • SLT IIb
    • SLT2b
    • stx2B
    • stxB2
    • Verocytotoxin 2 subunit B
    • Verotoxin 2 subunit B
    see all
  • Relevance

    Verotoxins are produced by certain enterohaemorrhagic strains of Escherichia coli. Serotype O157:H7 has been the strain most commonly associated with large food bourne outbreaks and has been implicated in a wide spectrum of diseases including blood diarrhoea, haemorrhagic colitis and haemolytic uraemic syndrome. The main sources of infection are contaminated foods of animal origin such as meat and dairy products. Verotoxins, also called Shiga like toxins( SLT) because of their similarity to toxins produced by Shigella dysenteriae, are classified into two main categories: verotoxin 1 (VT1, SLT1, Stx1) and 2 (VT2, SLT2, Stx2). Verotoxin production is the most common criteria for the detection of this group of bacteria rather than tests for the cytopathic effect on Vero cells that gave the toxins their name. Verotoxins contain a single A subunit and multiple copies of a B subunit. The A subunit is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits.
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236926.

References

ab236926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up