Recombinant Viral interleukin-10 homolog protein (ab238283)

Description

  • Product name

    Recombinant Viral interleukin-10 homolog protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTV VKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDM RQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSR K
    • Predicted molecular weight

      18 kDa
    • Amino acids

      26 to 176
    • Additional sequence information

      Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5).

Specifications

Our Abpromise guarantee covers the use of ab238283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238283.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238283 could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) UL111A.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238283 could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) UL111A.

References

ab238283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up