Description

  • Product name

    Recombinant VP2 protein
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Enterovirus A71
    • Sequence

      SPSAEACGYSDRVAQLTIGNSTITTQEAANIIVGYGEWPSYCSDSDATAV DKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHY LYRSGFCIHVQCNASKFHQGVLLVAVLPEYVIGTVAGGTGTEDSHPPYKQ TQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYINA LPFDSALNHCNFGLLVVPISPLDYDQGATPVIPITITLAPMCSEFAGLRQ AVTQ
    • Predicted molecular weight

      28 kDa
    • Amino acids

      70 to 323
    • Tags

      GST tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab214830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 52% PBS, 48% Urea

  • Reconstitution
    Reconstitute with 100 µl distilled sterile water.

Images

  • SDS-PAGE analysis of ab214830.

References

ab214830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up