Recombinant Woodchuck Interferon gamma protein (His tag) (ab225661)
Key features and details
- Expression system: Yeast
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
Description
-
Product name
Recombinant Woodchuck Interferon gamma protein (His tag)
See all Interferon gamma proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Woodchuck -
Sequence
QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIV SFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQV NDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK -
Predicted molecular weight
19 kDa including tags -
Amino acids
24 to 166 -
Tags
His tag N-Terminus -
Additional sequence information
Marmota monax (Woodchuck) protein. This product is the mature full length protein from aa 24 to 166. The signal peptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab225661 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
SDS-PAGE
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
General Info
-
Alternative names
- IF 1
- IFG
- IFI
see all -
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. -
Tissue specificity
Released primarily from activated T lymphocytes. -
Involvement in disease
In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis. -
Sequence similarities
Belongs to the type II (or gamma) interferon family. -
Post-translational
modificationsProteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. -
Cellular localization
Secreted. - Information by UniProt
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225661 with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab225661 could indicate that this peptide derived from Yeast-expressed Marmota monax (Woodchuck) Interferon gamma.
-
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab225661 could indicate that this peptide derived from Yeast-expressed Marmota monax (Woodchuck) Interferon gamma.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab225661 has not yet been referenced specifically in any publications.