Recombinant Yersinia pestis F1 antigen protein (His tag) (ab236940)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Yersinia pestis F1 antigen protein (His tag)
See all Yersinia pestis F1 antigen proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Yersinia pestis -
Sequence
ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGG YKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISP KVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ -
Predicted molecular weight
18 kDa -
Amino acids
22 to 170 -
Tags
His tag N-Terminus -
Additional sequence information
Full length mature chain without the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab236940 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Caf1
- F1 capsule antigen
-
Relevance
Yersinia pestis is a gram-negative coccobacillus belonging to the Enterobacteriaceae. Yersinia pestis is primarily a rodent pathogen, with humans being an accidental host when bitten by an infected rat flea. The flea draws viable Y. pestis organisms into its intestinal tract. Some Y. pestis in the flea are then regurgitated when the flea gets its blood meal thus transferring the infection to a new host. While growing in the flea, Y. pestis loses its capsular layer, which is made of the F1 (or fraction 1) capsule antigen. Most of the organisms are phagocytosed and killed by the polymorphonuclear leukocytes in the human host. A few bacilli are taken up by tissue macrophages. The macrophages are unable to kill Y. pestis and provide a protected environment for the organisms to synthesize their virulence factors. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant Yersinia pestis F1 antigen protein (His tag) (ab236940)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236940.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab236940 has not yet been referenced specifically in any publications.
