Recombinant Zebov Envelope Glycoprotein (ab200054)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Sequence

      IPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSA TKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGF PRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVA FLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEY LFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGK LIWKVNPE IDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISGQSPARTSSDP GTNTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQSLTT KPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDTPSATTAAGPP KAENTNTSKSTDFLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLG LITNTIAGVAGLITGGRRTRR
    • Molecular weight

      57 kDa including tags
    • Amino acids

      33 to 501
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Zaire Ebola Virus (Zebov) full length glycoprotein 1 (GP1); from within envelope glycoprotein. NP_066246.

Specifications

Our Abpromise guarantee covers the use of ab200054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Storing diluted protein is not recommended, if necessary, use carrier protein (BSA 0.1 – 0.5%).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 79% Phosphate Buffer, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • GP
    • GP 1,2
    • GP1
    • GP2
    • GP2-delta
    • Spike glycoprotein
    • Virion spike glycoprotein
    see all
  • Cellular localization

    Virion membrane; Peripheral membrane protein.

Images

  • 4-20% SDS-PAGE Coomassie staining: using 4 µg ab200054

References

ab200054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up