Description

  • Product name

    Recombinant Zebrafish CSN2 protein (His tag)
    See all CSN2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Zebrafish
    • Sequence

      MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA LSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIR SAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFK TNTKLGKLYLEREEFGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYAL EIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGE FEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTING RIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAIVSKLA
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 443
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab241264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TRIP15

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, Glycerol

General Info

  • Alternative names

    • ALIEN
    • Alien Drosophila himolog of
    • Alien homolog
    • COP 9
    • COP9
    • COP9 constitutive photomorphogenic homolog subunit 2
    • COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
    • COP9 signalosome complex subunit 2
    • COPS 2
    • Cops2
    • CSN2
    • CSN2_HUMAN
    • JAB1 containing signalosome subunit 2
    • JAB1-containing signalosome subunit 2
    • SGN 2
    • SGN2
    • Signalosome subunit 2
    • Thyroid Hormone Receptor Interactor15
    • Thyroid Hormone Receptor Interactor 15
    • Thyroid receptor-interacting protein 15
    • TR-interacting protein 15
    • TRIP 15
    • TRIP-15
    • TRIP15
    see all
  • Function

    Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.
  • Sequence similarities

    Belongs to the CSN2 family.
    Contains 1 PCI domain.
  • Post-translational
    modifications

    Phosphorylated by CK2 and PKD kinases.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • Analysis of ab241264 by (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab241264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up