Recombinant Zebrafish TNF superfamily member 2 protein (His tag) (ab236167)

Description

  • Product name

    Recombinant Zebrafish TNF superfamily member 2 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Zebrafish
    • Sequence

      AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVS YETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTS YSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      101 to 242
    • Tags

      His tag N-Terminus
    • Additional sequence information

      TNF-2 domain.

Specifications

Our Abpromise guarantee covers the use of ab236167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • Analysis of ab236167 by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab236167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up