Recombinant Enhanced GFP protein (His tag) (ab134853)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Enhanced GFP protein (His tag)
See all GFP proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab134853 was expressed in E.coli as soluble protein and was purified using a Ni-NTA column. -
Endotoxin level
5.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Aequorea victoria -
Sequence
MGDIMGEWGNEIFGAIAGFLGVSKGEELFTGVVPILVELDGDVNGHKFSV SGEGEGDATYGKLT LKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYV QERTIFFKDDGNYK TRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQ KNGIKVNFKIRHNI EDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDE LYKSRHRRHRQRSRSRAAARRRRRRRRRHHHHHH -
Predicted molecular weight
33 kDa -
Amino acids
2 to 238 -
Tags
His tag C-Terminus -
Additional sequence information
Second generation monomeric GFP (Enhanced GFP). Constructed with a N-terminal tag of HA2 peptide and C-terminal 9 arginine domain/His Tag.
-
-
Description
Recombinant A. victoria GFP protein (His tag)
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab134853 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
This version of GFP is the second generation monomeric green fluorescent protein (Enhanced GFP) that has improved brightness and photostability.
This EGFP-9R, have a single excitation peak centered at about 488 nm, with an emission peak wavelength of 509 nm.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Store In the Dark.
Constituents: 79% PBS, 20% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- GFP
- Green fluorescent protein
-
Relevance
Function: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+ -activated photoprotein aequorin.
Subunit structure: Monomer.
Tissue specificity: Photocytes.
Post-translational modification: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen.
Biotechnological use: Green fluorescent protein has been engineered to produce a vast number of variously colored mutants, fusion proteins, and biosensors. Fluorescent proteins and its mutated allelic forms, blue, cyan and yellow have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Can also be used as a molecular thermometer, allowing accurate temperature measurements in fluids. The measurement process relies on the detection of the blinking of GFP using fluorescence correlation spectroscopy.
Sequence similarities: Belongs to the GFP family.
Biophysicochemical properties: Absorption: Abs(max)=395 nm
Exhibits a smaller absorbance peak at 470 nm. The fluorescence emission spectrum peaks at 509 nm with a shoulder at 540 nm.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab134853 has been referenced in 2 publications.
- Castro L et al. Kir6.2, the Pore-Forming Subunit of ATP-Sensitive K+ Channels, Is Overexpressed in Human Posttraumatic Brain Contusions. J Neurotrauma 36:165-175 (2019). PubMed: 29737232
- Scherr TF et al. A two-magnet strategy for improved mixing and capture from biofluids. Biomicrofluidics 10:024118 (2016). PubMed: 27158286