Overview

  • Product name

  • Description

    Rabbit polyclonal to RECQL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RECQL5 aa 582-681.
    Sequence:

    ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQA EPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ


    Database link: O94762

  • Positive control

    • WB: A549 cell lysate. IHC-P: Human skeletal muscle tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 46,49,106,109 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May have an important role in DNA metabolism.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the helicase family. RecQ subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Cytoplasm and Nucleus > nucleoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP-dependent DNA helicase Q5 antibody
    • DNA helicase antibody
    • DNA helicase, RecQ like type 5 antibody
    • DNA helicase, RECQ-like, type 5 antibody
    • EC 3.6.1.- antibody
    • FLJ90603 antibody
    • RecQ helicase protein-like 5 beta antibody
    • RecQ protein-like 5 antibody
    • RecQ protein-like 5, isoform CRA_b antibody
    • RecQ-like type 5 antibody
    • RecQ5 antibody
    • RECQ5_HUMAN antibody
    • Recq5b antibody
    • RECQL5 antibody
    • Recql5b antibody
    see all

Images

  • Anti-RECQL5 antibody (ab224135) at 1/100 dilution + A549 (human lung carcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 46,49,106,109 kDa

  • Paraffin-embedded human skeletal muscle tissue stained for RECQL5 using ab224135 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for RECQL5 (green) using ab224135 at 4 µg/ml in ICC/IF.

References

ab224135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up