Overview

  • Product name

  • Description

    Rabbit polyclonal to RED
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RED aa 1-192. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSA PPSKSRHHEMPREYNEDEDPAARRRKKKSYYAKLRQQEIERERELAEKYR DRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAAEKRRQLIQES KFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKP


    Database link: Q13123

  • Positive control

    • WB: Recombinant human RED protein; HEK-293T and HeLa whole cell lysates; Pig liver and kidney tissue lysates. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 66 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for RED using ab233163 at 20μg/ml in immunohistochemical analysis.

  • Anti-RED antibody (ab233163) at 3 µg/ml + Recombinant human RED

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 66 kDa

  • All lanes : Anti-RED antibody (ab233163) at 3 µg/ml

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Pig liver tissue lysate
    Lane 4 : Pig kidney tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 66 kDa

References

ab233163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up