Overview

  • Product name

  • Description

    Rabbit polyclonal to Reelin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Reelin aa 241-340.
    Sequence:

    TFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSIIVLYAKNN SADWIQLEKIRAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYE


    Database link: P78509

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation.
  • Tissue specificity

    Abundantly produced during brain ontogenesis by the Cajal-Retzius cells and other pioneer neurons located in the telencephalic marginal zone and by granule cells of the external granular layer of the cerebellum. In adult brain, preferentially expressed in GABAergic interneurons of prefrontal cortices, temporal cortex, hippocampus and glutamatergic granule cells of cerebellum. Expression is reduced to about 50% in patients with schizophrenia. Also expressed in fetal and adult liver.
  • Involvement in disease

    Lissencephaly 2
  • Sequence similarities

    Belongs to the reelin family.
    Contains 16 BNR repeats.
    Contains 8 EGF-like domains.
    Contains 1 reelin domain.
  • Developmental stage

    Expressed in fetal and postnatal brain and liver. Expression in postnatal human brain is high in the cerebellum.
  • Domain

    The basic C-terminal region is essential for secretion.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • LIS2 antibody
    • PRO1598 antibody
    • Reeler antibody
    • Reelin antibody
    • RELN antibody
    • RELN_HUMAN antibody
    • RL antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized U-2 OS cells labeling Reelin with ab220371 at 4 µg/mL (green).

References

ab220371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up