Overview

  • Product name

    Anti-REEP1 antibody [S345-51]
    See all REEP1 primary antibodies
  • Description

    Mouse monoclonal [S345-51] to REEP1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Fusion protein corresponding to Mouse REEP1 aa 111-201. NP_848723.1
    Sequence:

    KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRS FSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGT A


    Database link: Q8BGH4

  • Positive control

    • ICC/IF: SK-N-BE cells. WB: Rat brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.1% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    S345-51
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab242004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 22 kDa.
ICC/IF 1/100.

Target

  • Function

    May enhance the cell surface expression of odorant receptors.
  • Involvement in disease

    Defects in REEP1 are the cause of spastic paraplegia autosomal dominant type 31 (SPG31) [MIM:610250]. Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body.
  • Sequence similarities

    Belongs to the DP1 family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C2orf23 antibody
    • Chromosome 2 open reading frame 23 antibody
    • FLJ13110 antibody
    • Receptor accessory protein 1 antibody
    • Receptor expression-enhancing protein 1 antibody
    • Reep1 antibody
    • REEP1_HUMAN antibody
    • SPG31 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of SK-N-BE (Human neuroblastoma cell line) cells labeling REEP1 using ab242004 at 1:100 for 60 minutes at RT. Cells were fixed in 4% formaldehyde for 15 minutes at RT.

    Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 minutes at RT.

    Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min RT, 5 min RT.

    (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) ab242004 (D) Composite.

  • Anti-REEP1 antibody [S345-51] (ab242004) at 1/1000 dilution (16 hours at +4degC) + Rat brain lysate at 20 µg

    Secondary
    Goat Anti-Mouse IgG: HRP, 1 hour at RT

    Developed using the ECL technique.

    Predicted band size: 22 kDa


    Exposure time: 6 minutes

References

ab242004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up