Overview

  • Product name

    Anti-REEP2 antibody [S326D-2]
    See all REEP2 primary antibodies
  • Description

    Mouse monoclonal [S326D-2] to REEP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Fusion protein corresponding to Mouse REEP2 aa 111-254. (Cytoplasmic C-terminus)
    Sequence:

    RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIR DEDALPLQGPDGRLQPGPVGLLDTIEDLGDEPALSLRSSTSQPDPRTETS EDDLGDKAPKRTKPIKKVPRAEPPASKTLKTRPKKKSSGGGDSA


    Database link: Q8VCD6

  • Positive control

    • WB: COS over expressing REEP2-His. ICC/IF: SK-N-BE cells.
  • General notes

     This product was previously labelled as C5orf19

     

Properties

Applications

Our Abpromise guarantee covers the use of ab242000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 28 kDa.
ICC/IF 1/100.

Target

  • Function

    May enhance the cell surface expression of odorant receptors.
  • Tissue specificity

    Detected in brain, heart and skeletal muscle, and at low levels in placenta, kidney and pancreas.
  • Sequence similarities

    Belongs to the DP1 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C5orf19 antibody
    • Chromosome 5 open reading frame 19 antibody
    • Receptor accessory protein 2 antibody
    • Receptor expression enhancing protein 2 antibody
    • Receptor expression-enhancing protein 2 antibody
    • REEP 2 antibody
    • REEP2 antibody
    • REEP2_HUMAN antibody
    • SGC32445 antibody
    • SPG72 antibody
    see all

Images

  • 4% formaldehyde-fixed SK-N-BE (human neuroblastoma cell line) cells stained for REEP2 (green, C) using ab242000 at 1/100 dilution  for 1 hour at room temperature in ICC/IF. Secondary antibody is Goat Anti-Mouse ATTO 488 at 1/100 dilution at a 1 hr at RT. Actin is detected with Phalloidin Texas Red F-Actin stain (red, B). The nuclear counterstain is DAPI (blue, A). (D) is a composite image.

  • All lanes : Anti-REEP2 antibody [S326D-2] (ab242000) at 1/1000 dilution

    Lane 1 : COS overexpressing REEP1-His cell lysate at 15 µg
    Lane 2 : COS overexpressing REEP2-His cell lysate
    Lane 3 : COS overexpressing REEP6-His cell lysate

    Secondary
    All lanes : Goat Anti-Mouse IgG: HRP at 1/200 dilution

    Developed using the ECL technique.

    Predicted band size: 28 kDa


    Exposure time: 6 minutes


    Primary incubation for 16 hours at 4°C.

    Secondary incubation for 1 hr at RT.

    Blocked for 1 hr at RT.

    Note: C5orf19 = REEP2

References

ab242000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up