Overview

  • Product name

  • Description

    Rabbit polyclonal to REEP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human REEP4 aa 78-257.
    Sequence:

    SPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLSFGKRGLN IAASAAVQAATKSQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQV SHRRPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRV VKRKPPVREGTSRSLKVRTRKKTVPSDVDS


    Database link: Q9H6H4-1

  • Positive control

    • WB: U-251 MG whole cell lysate. IHC-P: Human adrenal gland, testis and small intestine tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab237689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May enhance the cell surface expression of odorant receptors.
  • Sequence similarities

    Belongs to the DP1 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C8orf20 antibody
    • FLJ22246 antibody
    • FLJ22277 antibody
    • PP432 antibody
    • Receptor accessory protein 4 antibody
    • Receptor expression-enhancing protein 4 antibody
    • Reep4 antibody
    • REEP4_HUMAN antibody
    see all

Images

  • Anti-REEP4 antibody (ab237689) at 1/500 dilution + U-251 MG (Human brain glioma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human adrenal gland tissue stained for REEP4 using ab237689 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for REEP4 using ab237689 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for REEP4 using ab237689 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for REEP4 (Green) using ab237689 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab237689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up