Overview

  • Product name

  • Description

    Rabbit polyclonal to REEP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human REEP5 aa 129-185.
    Sequence:

    PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKAT VNLLGEE


    Database link: Q00765

  • Positive control

    • ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    May promote functional cell surface expression of olfactory receptors.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • C5orf18 antibody
    • D5S346 antibody
    • Deleted in polyposis 1 antibody
    • DP1 antibody
    • Polyposis coli region hypothetical protein DP1 antibody
    • Polyposis locus protein 1 antibody
    • Protein TB2 antibody
    • Receptor accessory protein 5 antibody
    • Receptor expression enhancing protein 5 antibody
    • TB2 antibody
    • TB2 protein antibody
    • YOP1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for REEP5 (green) using ab221810 at 4 µg/ml in ICC/IF.

References

ab221810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up