Overview

  • Product name

  • Description

    Rabbit polyclonal to REEP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human REEP5 aa 120-189.
    Sequence:

    FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADA ITKEAKKATVNLLGEEKKST


    Database link: Q00765

  • Positive control

    • WB: Mouse kidney and lung tissue lysate; Jurkat, MCF7, K562 and HeLa whole cell lysate (ab150035). IHC-P: Human colon cancer and skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 21 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-REEP5 antibody (ab230115) at 1/1000 dilution

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : Mouse lung tissue lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 5 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 6 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 21 kDa
    Observed band size: 21 kDa

  • Paraffin-embedded human colon cancer tissue stained for REEP5 using ab230115 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for REEP5 using ab230115 at 1/100 dilution in immunohistochemical analysis.

References

ab230115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up