Anti-REEP5 antibody (ab230123)
Key features and details
- Rabbit polyclonal to REEP5
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-REEP5 antibody
See all REEP5 primary antibodies -
Description
Rabbit polyclonal to REEP5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human REEP5 aa 120-189.
Sequence:FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADA ITKEAKKATVNLLGEEKKST
Database link: Q00765 -
Positive control
- WB: MCF7, K562 and HeLa whole cell lysates. IHC-P: Human colon cancer and skin tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab230123 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/10000 - 1/5000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa). |
Target
-
Relevance
May promote functional cell surface expression of olfactory receptors. -
Cellular localization
Cell Membrane -
Database links
- Entrez Gene: 7905 Human
- Entrez Gene: 100174273 Orangutan
- Omim: 125265 Human
- SwissProt: Q00765 Human
- SwissProt: Q5RE33 Orangutan
- Unigene: 429608 Human
-
Alternative names
- C5orf18 antibody
- D5S346 antibody
- Deleted in polyposis 1 antibody
see all
Images
-
All lanes : Anti-REEP5 antibody (ab230123) at 1/1000 dilution
Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 21 kDa
Observed band size: 21 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REEP5 antibody (ab230123)
Paraffin-embedded human colon cancer tissue stained for REEP5 using ab230123 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REEP5 antibody (ab230123)
Paraffin-embedded human skin tissue stained for REEP5 using ab230123 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230123 has not yet been referenced specifically in any publications.