Anti-REEP5 antibody (ab230123)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-REEP5 antibody
See all REEP5 primary antibodies -
Description
Rabbit polyclonal to REEP5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant fragment corresponding to Human REEP5 aa 120-189.
Sequence:FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADA ITKEAKKATVNLLGEEKKST
Database link: Q00765 -
Positive control
- WB: MCF7, K562 and HeLa whole cell lysates. IHC-P: Human colon cancer and skin tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab230123 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/10000 - 1/5000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa). |
Target
-
Relevance
May promote functional cell surface expression of olfactory receptors. -
Cellular localization
Cell Membrane -
Database links
- Entrez Gene: 7905 Human
- Entrez Gene: 100174273 Orangutan
- Omim: 125265 Human
- SwissProt: Q00765 Human
- SwissProt: Q5RE33 Orangutan
- Unigene: 429608 Human
-
Alternative names
- C5orf18 antibody
- D5S346 antibody
- Deleted in polyposis 1 antibody
see all
Images
-
Western blot - Anti-REEP5 antibody (ab230123)All lanes : Anti-REEP5 antibody (ab230123) at 1/1000 dilution
Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 21 kDa
Observed band size: 21 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REEP5 antibody (ab230123)Paraffin-embedded human colon cancer tissue stained for REEP5 using ab230123 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REEP5 antibody (ab230123)Paraffin-embedded human skin tissue stained for REEP5 using ab230123 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab230123 has not yet been referenced specifically in any publications.
