Overview

  • Product name

    Anti-REEP6 antibody
  • Description

    Rabbit polyclonal to REEP6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human REEP6 aa 1-42 (N terminal).
    Sequence:

    MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT


    Database link: Q96HR9

  • Positive control

    • Human testis tissue; Human liver tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 20 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in intracellular protein transport from the endoplasmic reticulum to the cell surface. May play a role in retinal development.
  • Tissue specificity

    Expressed in circumvallate papillae and testis.
  • Sequence similarities

    Belongs to the DP1 family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610011M24Rik antibody
    • C19orf32 antibody
    • Deleted in polyposis 1 like 1 antibody
    • Dp1l1 antibody
    • FLJ25383 antibody
    • OTTMUSP00000020650 antibody
    • OTTMUSP00000020651 antibody
    • OTTMUSP00000020652 antibody
    • OTTMUSP00000021713 antibody
    • OTTMUSP00000021714 antibody
    • Polyposis locus protein 1 like 1 antibody
    • Polyposis locus protein 1-like 1 antibody
    • Receptor accessory protein 6 antibody
    • Receptor expression enhancing protein 6 antibody
    • Receptor expression-enhancing protein 6 antibody
    • REEP6 antibody
    • REEP6_HUMAN antibody
    • TB2 protein like 1 antibody
    • TB2L1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling REEP6 with ab204341 at 1/200 dilution.

  • All lanes : Anti-REEP6 antibody (ab204341) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 20 kDa

References

ab204341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up