Overview

  • Product name

  • Description

    Rabbit polyclonal to REG1 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse REG1 alpha aa 10-165. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    LSCLIVLSPSQGQEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADA DLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRR WHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSF VCKFKG


    Database link: P43137

  • Positive control

    • WB: Recombinant mouse REG1 alpha; rat pancreas tissue lysate. IHC-P: Rat pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 19 kDa.

Target

  • Function

    Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
  • Tissue specificity

    In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    High expression levels in fetal and infant brains; much lower in adult brains.
  • Post-translational
    modifications

    The composition of the O-linked carbohydrate on Thr-27 is complex and varied. In the crystallographic structure, the attached sugar appears to be N-acetylglucosamine, typical of an intracellular protein, rather than N-acetylgalactosamine.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ICRF antibody
    • Islet cells regeneration factor antibody
    • Islet of Langerhans regenerating protein antibody
    • Lithostathine 1 alpha antibody
    • Lithostathine 1 alpha precursor antibody
    • Lithostathine antibody
    • Lithostathine-1-alpha antibody
    • MGC12447 antibody
    • P19 antibody
    • Pancreatic stone protein antibody
    • Pancreatic stone protein secretory antibody
    • Pancreatic thread protein antibody
    • Protein X antibody
    • PSP antibody
    • PSPS antibody
    • PSPS1 antibody
    • PTP antibody
    • RATRGPI antibody
    • REG antibody
    • REG-1-alpha antibody
    • Reg1 antibody
    • REG1A antibody
    • REG1A_HUMAN antibody
    • Regenerating islet derived 1 alpha antibody
    • Regenerating islet derived 1 alpha pancreatic stone protein pancreatic thread protein antibody
    • Regenerating islet-derived protein 1-alpha antibody
    • Regenerating protein I alpha antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for REG1 alpha with ab231087 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-REG1 alpha antibody (ab231087) at 1 µg/ml + Rat pancreas tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 19 kDa

  • Anti-REG1 alpha antibody (ab231087) at 2 µg/ml + Recombinant mouse REG1 alpha

    Predicted band size: 19 kDa

References

ab231087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up