Overview

  • Product name

    Anti-REG1B antibody
  • Description

    Rabbit polyclonal to REG1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human REG1B aa 23-166. Mature form. (Expressed in E.coli).
    Sequence:

    QESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNL VSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYK SWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN


    Database link: P48304

  • Positive control

    • WB: Human urine; Mouse pancreas lysate; Recombinant human REG1B protein. IHC-P: Human stomach, stomach cancer and pancreas tissue.
  • General notes

     This product was previously labelled as REG1 beta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    All O-linked glycans consist of Gal-GlcNAc-Gal-GalNAc tetrasaccharide core and get elongated (microheterogeneity).
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Lithostathine 1 beta antibody
    • Lithostathine 1 beta precursor antibody
    • Lithostathine-1-beta antibody
    • Pancreatic stone protein 2 antibody
    • PSP 2 antibody
    • PSP-2 antibody
    • PSPS2 antibody
    • REG 1 beta antibody
    • REG-1-beta antibody
    • REG1B antibody
    • REG1B_HUMAN antibody
    • Regenerating islet derived 1 beta (pancreatic stone protein pancreatic thread protein) antibody
    • Regenerating islet derived 1 beta antibody
    • Regenerating islet derived protein 1 beta antibody
    • Regenerating islet-derived protein 1-beta antibody
    • Regenerating protein I beta antibody
    • REGH antibody
    • REGI BETA antibody
    • REGL antibody
    • Secretory pancreatic stone protein 2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for REG1B using ab233210 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for REG1B using ab233210 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for REG1B using ab233210 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-REG1B antibody (ab233210) at 3 µg/ml

    Lane 1 : Human urine
    Lane 2 : Mouse pancreas tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-REG1B antibody (ab233210) at 5 µg/ml + Recombinant human REG1B protein

References

ab233210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up