Overview

  • Product name

    Anti-REG3G antibody [C13]
    See all REG3G primary antibodies
  • Description

    Mouse monoclonal [C13] to REG3G
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human REG3G aa 39-175. N-terminal His and T7 tags. Expressed in E. coli.
    Sequence:

    SCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFV SSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPS TILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD


    Database link: Q6UW15-1

  • Positive control

    • IHC-P: Human pancreas tissue. WB: Recombinant human REG3G protein. Human serum.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C13
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Might be a stress protein involved in the control of bacterial proliferation.
  • Tissue specificity

    Expressed almost exclusively in the pancreas. Also expressed in testis. Not found in small intestine.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • LPPM429 antibody
    • Pancreatitis-associated protein 1B antibody
    • Pancreatitis-associated protein IB antibody
    • PAP IB antibody
    • PAP-1B antibody
    • PAP1B antibody
    • PAPIB antibody
    • REG III antibody
    • Reg III-gamma antibody
    • REG-3-gamma antibody
    • REG3G antibody
    • REG3G_HUMAN antibody
    • Regenerating islet derived 3 gamma antibody
    • Regenerating islet-derived protein 3-gamma antibody
    • Regenerating islet-derived protein III-gamma antibody
    • UNQ429 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for REG3G with ab239610 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-REG3G antibody [C13] (ab239610) at 3 µg/ml + Human serum

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml
  • Anti-REG3G antibody [C13] (ab239610) at 5 µg/ml + Recombinant human REG3G protein

References

ab239610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up