Overview

  • Product name

  • Description

    Rabbit polyclonal to REG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human REG4 aa 90-158.
    Sequence:

    QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFL TWSSNECNKRQHFLCKYRP


    Database link: Q9BYZ8

  • Positive control

    • Human small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium.
  • Tissue specificity

    Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gastrointestinal secretory protein antibody
    • GISP antibody
    • Reg IV antibody
    • REG like protein antibody
    • REG-4 antibody
    • REG-like protein antibody
    • Reg4 antibody
    • REG4_HUMAN antibody
    • Regenerating gene type IV antibody
    • Regenerating islet derived family member 4 antibody
    • Regenerating islet derived protein 4 precursor antibody
    • Regenerating islet-derived protein 4 antibody
    • Regenerating islet-derived protein IV antibody
    • REGIV antibody
    • RELP antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intesting tissue labeling REG4 with ab204171 at 1/200 dilution.

References

ab204171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up