Overview

  • Product name

  • Description

    Rabbit polyclonal to Rel B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Rel B aa 400-579.
    Sequence:

    RDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFLPNH GSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPTLF TMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGT ASLVGSNMFPNHYREAAFGGGLLSPGPEAT


    Database link: Q01201

  • Positive control

    • WB: NIH/3T3 whole cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 62 kDa.
ICC/IF 1/50 - 1/500.

Target

  • Function

    NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric RelB-p50 and RelB-p52 complexes are transcriptional activators. RELB neither associates with DNA nor with RELA/p65 or REL. Stimulates promoter activity in the presence of NFKB2/p49.
  • Sequence similarities

    Contains 1 RHD (Rel-like) domain.
  • Domain

    Both N- and C-terminal domains are required for transcriptional activation.
  • Post-translational
    modifications

    Phosphorylation at 'Thr-103' and 'Ser-573' is followed by proteasomal degradation.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > centrosome. Co-localizes with NEK6 in the centrosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • I REL antibody
    • I-Rel antibody
    • IREL antibody
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells 3 antibody
    • relB antibody
    • RELB_HUMAN antibody
    • Reticuloendotheliosis viral oncogene homolog B antibody
    • Transcription factor Rel B antibody
    • Transcription factor RelB antibody
    • v rel avian reticuloendotheliosis viral oncogene homolog B antibody
    • v rel reticuloendotheliosis viral oncogene homolog B antibody
    see all

Images

  • Anti-Rel B antibody (ab235922) at 1/2000 dilution + NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 62 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Rel B (green) using ab235922 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated AffiniPure Goat Anti-Rabbit IgG (H+L).

References

ab235922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up