Overview

  • Product name

    Anti-Relaxin 2/RLN2 antibody
    See all Relaxin 2/RLN2 primary antibodies
  • Description

    Rabbit polyclonal to Relaxin 2/RLN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Relaxin 2/RLN2 aa 1-185. (Expressed in E.coli).
    Sequence:

    MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMS TWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKL TLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKY LGLDTHSRKKRQLYSALANKCCHVGCTKRSLARF


    Database link: P04090

  • Positive control

    • WB: Human placenta lysate; Recombinant human Relaxin 2/RLN2 protein. IHC-P: Human cerebrum, liver and liver cancer tissue.
  • General notes

     This product was previously labelled as Relaxin 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml.

Target

  • Function

    Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Tissue specificity

    Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary.
  • Sequence similarities

    Belongs to the insulin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Form

    Prorelaxin 2 is Cleaved into the following 2 chains: 1.Relaxin B chain - aa 25-53. 2.Relaxin A chain - aa 162-185. The signal peptide is from aa 1-24.
  • Alternative names

    • H2 antibody
    • REL2_HUMAN antibody
    • Relaxin 2 antibody
    • Relaxin A chain antibody
    • Relaxin H2 antibody
    • RLN2 antibody
    • RLXH2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Relaxin 2/RLN2 using ab232707 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Relaxin 2/RLN2 using ab232707 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Relaxin 2/RLN2 using ab232707 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Relaxin 2/RLN2 antibody (ab232707) at 2 µg/ml + Human placenta lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-Relaxin 2/RLN2 antibody (ab232707) at 2 µg/ml + Recombinant human Relaxin 2/RLN2 protein

References

ab232707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up