Overview

  • Product name

  • Description

    Sheep polyclonal to Renin
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Mouse Renin aa 1-402.
    Sequence:

    MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILEERGVD MTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVI FDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSG RVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQA VGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGN FHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSL KLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQY PNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFAL AR


    Database link: P06281

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab176127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 45 kDa.

Target

  • Function

    Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
  • Involvement in disease

    Defects in REN are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
    Defects in REN are the cause of familial juvenile hyperuricemic nephropathy type 2 (HNFJ2) [MIM:613092]. It is a renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia.
  • Sequence similarities

    Belongs to the peptidase A1 family.
  • Cellular localization

    Secreted. Membrane. Associated to membranes via binding to ATP6AP2.
  • Information by UniProt
  • Database links

  • Alternative names

    • Angiotensin forming enzyme antibody
    • Angiotensin forming enzyme precursor antibody
    • Angiotensinogenase antibody
    • Angiotensinogenase precursor antibody
    • FLJ10761 antibody
    • HNFJ2 antibody
    • REN antibody
    • Ren1 antibody
    • RENI_HUMAN antibody
    • Renin antibody
    • Renin precursor renal antibody
    see all

References

ab176127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up