Anti-Renin antibody (ab180608)
Key features and details
- Rabbit polyclonal to Renin
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Renin antibody
See all Renin primary antibodies -
Description
Rabbit polyclonal to Renin -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey -
Immunogen
Recombinant full length protein corresponding to Human Renin aa 67-406. Mature protein.
Sequence:LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSK CSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVG GITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQ GVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGV WQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKK RLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Database link: P00797 -
Positive control
- K562, 293T and HepG2 cell extracts.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Assay kits
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180608 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/2000. Predicted molecular weight: 45 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 45 kDa. |
Target
-
Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. -
Involvement in disease
Defects in REN are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
Defects in REN are the cause of familial juvenile hyperuricemic nephropathy type 2 (HNFJ2) [MIM:613092]. It is a renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia. -
Sequence similarities
Belongs to the peptidase A1 family. -
Cellular localization
Secreted. Membrane. Associated to membranes via binding to ATP6AP2. - Information by UniProt
-
Database links
- Entrez Gene: 5972 Human
- Omim: 179820 Human
- SwissProt: P00797 Human
- Unigene: 3210 Human
-
Alternative names
- Angiotensin forming enzyme antibody
- Angiotensin forming enzyme precursor antibody
- Angiotensinogenase antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab180608 has been referenced in 3 publications.
- Lóry V et al. Obesity and aging affects skeletal muscle renin-angiotensin system and myosin heavy chain proportions in pre-diabetic Zucker rats. J Physiol Biochem 75:351-365 (2019). PubMed: 31197649
- Ding L et al. Elemene inhibits osteosarcoma growth by suppressing the renin-angiotensin system signaling pathway. Mol Med Rep 17:1022-1030 (2018). PubMed: 29115494
- Yan K & Shen Y Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system. Mol Med Rep 16:3965-3973 (2017). PubMed: 28765966