Anti-Renin antibody (ab180608)
- Datasheet
- References (3)
- Protocols
Overview
-
Product name
Anti-Renin antibody
See all Renin primary antibodies -
Description
Rabbit polyclonal to Renin -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey
-
Immunogen
Recombinant full length protein corresponding to Human Renin aa 67-406. Mature protein.
Sequence:LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSK CSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVG GITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQ GVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGV WQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKK RLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Database link: P00797 -
Positive control
- K562, 293T and HepG2 cell extracts.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Assay kits
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab180608 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2000. Predicted molecular weight: 45 kDa. |
Target
-
Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. -
Involvement in disease
Defects in REN are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
Defects in REN are the cause of familial juvenile hyperuricemic nephropathy type 2 (HNFJ2) [MIM:613092]. It is a renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia. -
Sequence similarities
Belongs to the peptidase A1 family. -
Cellular localization
Secreted. Membrane. Associated to membranes via binding to ATP6AP2. - Information by UniProt
-
Database links
- Entrez Gene: 5972 Human
- Entrez Gene: 19701 Mouse
- Entrez Gene: 19702 Mouse
- Omim: 179820 Human
- SwissProt: P00797 Human
- SwissProt: P00796 Mouse
- SwissProt: P06281 Mouse
- Unigene: 3210 Human
-
Alternative names
- Angiotensin forming enzyme antibody
- Angiotensin forming enzyme precursor antibody
- Angiotensinogenase antibody
see all
Images
-
Western blot - Anti-Renin antibody (ab180608)All lanes : Anti-Renin antibody (ab180608) at 1/500 dilution
Lane 1 : K562 cell extract
Lane 2 : 293T cell extract
Lane 3 : HepG2 cell extract
Predicted band size: 45 kDa
Protocols
Datasheets and documents
References
This product has been referenced in:
- Lóry V et al. Obesity and aging affects skeletal muscle renin-angiotensin system and myosin heavy chain proportions in pre-diabetic Zucker rats. J Physiol Biochem 75:351-365 (2019). Read more (PubMed: 31197649) »
- Ding L et al. Elemene inhibits osteosarcoma growth by suppressing the renin-angiotensin system signaling pathway. Mol Med Rep 17:1022-1030 (2018). Read more (PubMed: 29115494) »
