Anti-Renin antibody (ab180608)
Key features and details
- Rabbit polyclonal to Renin
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Renin antibody
See all Renin primary antibodies -
Description
Rabbit polyclonal to Renin -
Host species
Rabbit -
Tested Applications & Species
Application Species WB Human -
Immunogen
Recombinant full length protein corresponding to Human Renin aa 67-406. Mature protein.
Sequence:LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSK CSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVG GITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQ GVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGV WQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKK RLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Database link: P00797 -
Positive control
- K562, 293T and HepG2 cell extracts.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Assay kits
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180608 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
WB |
Human
|
All applications |
Chimpanzee
Cynomolgus monkey
Rhesus monkey
|
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/2000. Predicted molecular weight: 45 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 45 kDa. |
Target
-
Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. -
Involvement in disease
Defects in REN are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
Defects in REN are the cause of familial juvenile hyperuricemic nephropathy type 2 (HNFJ2) [MIM:613092]. It is a renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia. -
Sequence similarities
Belongs to the peptidase A1 family. -
Cellular localization
Secreted. Membrane. Associated to membranes via binding to ATP6AP2. - Information by UniProt
-
Database links
- Entrez Gene: 5972 Human
- Omim: 179820 Human
- SwissProt: P00797 Human
- Unigene: 3210 Human
-
Alternative names
- Angiotensin forming enzyme antibody
- Angiotensin forming enzyme precursor antibody
- Angiotensinogenase antibody
see all
Images
Datasheets and documents
References (3)
ab180608 has been referenced in 3 publications.
- Lóry V et al. Obesity and aging affects skeletal muscle renin-angiotensin system and myosin heavy chain proportions in pre-diabetic Zucker rats. J Physiol Biochem 75:351-365 (2019). PubMed: 31197649
- Ding L et al. Elemene inhibits osteosarcoma growth by suppressing the renin-angiotensin system signaling pathway. Mol Med Rep 17:1022-1030 (2018). PubMed: 29115494
- Yan K & Shen Y Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system. Mol Med Rep 16:3965-3973 (2017). PubMed: 28765966