Overview

  • Product name

  • Description

    Rabbit polyclonal to REPS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human REPS1 aa 610-712.
    Sequence:

    LITHTSTSPQQIPEQPNFADFSQFEVFAASNVNDEQDDEAEKHPEVLPAE KASDPASSLRVAKTDSKTEEKTAASAPANVSKGTTPLAPPPKPVRRRLKS EDE


    Database link: Q96D71

  • Positive control

    • U-2 OS cells and human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May coordinate the cellular actions of activated EGF receptors and Ral-GTPases.
  • Sequence similarities

    Contains 1 EF-hand domain.
    Contains 2 EH domains.
  • Post-translational
    modifications

    EGF stimulates phosphorylation on Tyr-residues.
  • Cellular localization

    Membrane > clathrin-coated pit. Colocalize with ITSN1 at the plasma membrane in structures that are most probably clathrin-coated pits.
  • Information by UniProt
  • Database links

  • Alternative names

    • RALBP1 antibody
    • RalBP1 associated Eps domain containing protein 1 antibody
    • RalBP1 interacting protein 1 antibody
    • RalBP1-associated Eps domain-containing protein 1 antibody
    • RalBP1-interacting protein 1 antibody
    • REPS1 antibody
    • REPS1_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of U-2 OS cells labeling REPS1 with ab204906 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded human testis tissue labeling REPS1 with ab204906 antibody at a dilution of 1/2500.

References

ab204906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up