Overview

  • Product name

    Anti-Repulsive Guidance Molecule A antibody
    See all Repulsive Guidance Molecule A primary antibodies
  • Description

    Rabbit polyclonal to Repulsive Guidance Molecule A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human Repulsive Guidance Molecule A aa 121-167.
    Sequence:

    TSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFG


    Database link: Q96B86

  • Positive control

    • ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS1-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8.
  • Sequence similarities

    Belongs to the repulsive guidance molecule (RGM) family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Repulsive guidance molecule A antibody
    • RGM antibody
    • RGM domain family member A antibody
    • RGMA antibody
    • RGMA_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized RH-30 cells labeling Repulsive Guidance Molecule A with ab220253 at 4 µg/mL (green).

References

ab220253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up