Overview

  • Product name

    Anti-RERE antibody
  • Description

    Rabbit polyclonal to RERE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human RERE aa 550-600 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRT S


    Database link: Q9P2R6

  • Positive control

    • A549 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab217756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 172 kDa.

Target

  • Function

    Plays a role as a transcriptional repressor during development. May play a role in the control of cell survival. Overexpression of RERE recruits BAX to the nucleus particularly to POD and triggers caspase-3 activation, leading to cell death.
  • Tissue specificity

    Widely expressed. Expressed in tumor cell lines.
  • Involvement in disease

    Note=A chromosomal aberration involving RERE is found in the neuroblastoma cell line. Translocation t(1;15)(p36.2;q24).
  • Sequence similarities

    Contains 1 BAH domain.
    Contains 1 ELM2 domain.
    Contains 1 GATA-type zinc finger.
    Contains 1 SANT domain.
  • Domain

    The interaction with ATN1 is mediated by the coiled coil domain.
  • Cellular localization

    Nucleus. Localized in nuclear bodies of variables size. Colocalized with PML and BAX in nuclear PODs.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110033A15Rik antibody
    • AI414665 antibody
    • ARG antibody
    • arginine glutamic acid dipeptide (RE) repeats antibody
    • arginine glutamic acid dipeptide repeats antibody
    • Arginine glutamic acid dipeptide repeats protein antibody
    • Arginine-glutamic acid dipeptide repeats protein antibody
    • ARGININE-GLUTAMIC ACID REPEATS-ENCODING GENE antibody
    • ARP antibody
    • ATN1L antibody
    • Atr2 antibody
    • atrophin 1 like antibody
    • Atrophin 1 like protein antibody
    • Atrophin 1 related protein antibody
    • atrophin 2 antibody
    • atrophin related protein antibody
    • ATROPHIN-1-ASSOCIATED PROTEIN antibody
    • Atrophin-1-like protein antibody
    • Atrophin-1-related protein antibody
    • atrophin-2 antibody
    • ATROPHIN-RELATED PROTEIN antibody
    • AW742570 antibody
    • DNB1 antibody
    • FLJ38775 antibody
    • KIAA0458 antibody
    • mKIAA0458 antibody
    • NEDBEH antibody
    • OTTHUMP00000001701 antibody
    • Rere antibody
    • RERE_HUMAN antibody
    see all

Images

  • Anti-RERE antibody (ab217756) at 1/300 dilution + A549 cell lysates

    Secondary
    Goat anti-rabbit IgG (H+L), HRP at 1/5000 dilution

    Predicted band size: 172 kDa



    8% gel.

References

ab217756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up