Overview

  • Product name

    Anti-RERG antibody
  • Description

    Rabbit polyclonal to RERG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human RERG aa 1-199.
    Sequence:

    MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATID DEVVSMEILDTAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKN ILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATELACAFYECSAC TGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS


    Database link: Q96A58

  • Positive control

    • WB: Mouse thymus lysate; rat lung lysate. IHC-P: Human placenta, skin and breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.

Target

  • Function

    Binds GDP/GTP and possesses intrinsic GTPase activity. Has higher affinity for GDP than for GTP. In cell lines overexpression leads to a reduction in the rate of proliferation, colony formation and in tumorigenic potential.
  • Tissue specificity

    Detected in heart, brain, placenta, lung, liver, skin, kidney and pancreas. Detected in estrogen receptor-positive breast-derived cell lines, but not in estrogen receptor-negative cell lines. Expression is decreased or lost in a significant proportion of primary breast tumors with poor clinical prognosis.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC15754 antibody
    • RAS like estrogen regulated growth inhibitor antibody
    • Ras related and estrogen regulated growth inhibitor antibody
    • Ras-related and estrogen-regulated growth inhibitor antibody
    • Rerg antibody
    • RERG_HUMAN antibody
    • Weakly similar to N ras protein [H.sapiens] antibody
    see all

Images

  • All lanes : Anti-RERG antibody (ab235439) at 1/500 dilution

    Lane 1 : Mouse thymus lysate
    Lane 2 : Rat lung lysate

    Secondary
    All lanes : Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 23 kDa

  • Paraffin-embedded human breast cancer tissue stained for RERG using ab235439 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for RERG using ab235439 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for RERG using ab235439 at 1/100 dilution in immunohistochemical analysis.

References

ab235439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up