Overview

  • Product name

  • Description

    Rabbit polyclonal to REST / NRSF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human REST/ NRSF aa 400-450 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    KKCNLQYHFKSKHPTCPNKTMDVSKVKLKKTKKREADLPDNITNEKTEIE Q


    Database link: Q13127

  • Positive control

    • Human gastric and Mouse brain tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab202962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 122 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.
  • Tissue specificity

    Ubiquitous. Expressed at higher levels in the tissues of the lymphocytic compartment, including spleen, thymus, peripheral blood lymphocytes and ovary.
  • Sequence similarities

    Contains 9 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neural Restrictive Silencer Factor antibody
    • Neural-restrictive silencer factor antibody
    • Neuron Restrictive Silencer Factor antibody
    • NRSF antibody
    • RE1 silencing transcription factor antibody
    • RE1-silencing transcription factor antibody
    • Repressor binding to the X2 box antibody
    • rest antibody
    • REST protein antibody
    • REST_HUMAN antibody
    • X2 box repressor antibody
    • XBR antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Mouse brain tissue labeling REST / NRSF with ab202962 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-REST / NRSF antibody (ab202962) at 1/300 dilution + Raji cell lysates

    Predicted band size: 122 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human gastric tissue staining ab202962 (1/200).

References

ab202962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Brain section - 50um)
Antigen retrieval step
None
Permeabilization
Yes - PBS-T 3 x 5mn
Specification
Brain section - 50um
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 13 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Pancreas)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium citrate
Specification
Pancreas
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Formalin

Dhruvit Sutaria

Verified customer

Submitted Aug 08 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up