Anti-Reston virus Nucleoprotein antibody (ab224744)

Overview

  • Product name

    Anti-Reston virus Nucleoprotein antibody
  • Description

    Rabbit polyclonal to Reston virus Nucleoprotein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
  • Immunogen

    Recombinant fragment corresponding to Reston virus Nucleoprotein aa 414-739. Reston ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola virus)
    Sequence:

    RPNLGSRQDDDNEIPFPGPISNNPDQDHLEDDPRDSRDTIIPNSAIDPED GDFENYNGYHDDEVGTAGDLVLFDLDDHEDDNKAFELQDSSPQSQREIER ERLIHPPPGNNKDDNRASDNNQQSADSEEQEGQYNRHRGPERTTANRRLS PVHEEDTPIDQGDDDPSSPPPLESDDDDASSSQQDPDYTAVAPPAPVYRS AEAHEPPHKSSNEPAETSQLNEDPDIGQSKSMQKLGETYHHLLRTQGPFE AINYYHMMKDEPVIFSTDDGKEYTYPDSLEEAYPPWLTEKERLDNENRYI YINNQQFFWPVMSPRDKFLAILQHHQ


    Database link: Q91DE1

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Images

  • All lanes : Anti-Reston virus Nucleoprotein antibody (ab224744) at 1/500 dilution

    Lane 1 : 80 ng recombinant protein
    Lane 2 : 60 ng recombinant protein
    Lane 3 : 40 ng recombinant protein

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.


    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab224744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up