Anti-Reticulocalbin 3 antibody (ab204178)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Reticulocalbin 3 antibody -
Description
Rabbit polyclonal to Reticulocalbin 3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human Reticulocalbin 3 aa 196-255.
Sequence:EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTE RQQFRDFRDL
Database link: Q96D15 -
Positive control
- Human cerebral cortex tissue; RT-4 and U-251 MG cell lysates; U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab204178 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | 1/500 - 1/1000. Predicted molecular weight: 37 kDa. |
Target
-
Sequence similarities
Belongs to the CREC family.
Contains 6 EF-hand domains. -
Cellular localization
Endoplasmic reticulum lumen. - Information by UniProt
-
Database links
- Entrez Gene: 57333 Human
- Entrez Gene: 52377 Mouse
- Entrez Gene: 494125 Rat
- SwissProt: Q2KJ39 Cow
- SwissProt: Q96D15 Human
- SwissProt: Q8BH97 Mouse
- Unigene: 567550 Human
-
Alternative names
- EF-hand calcium-binding protein RLP49 antibody
- RCN3 antibody
- RCN3_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling Reticulocalbin 3 with ab204178 at 1/2500 dilution.
-
Western blot - Anti-Reticulocalbin 3 antibody (ab204178)All lanes : Anti-Reticulocalbin 3 antibody (ab204178) at 1/500 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 37 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-Reticulocalbin 3 antibody (ab204178)Immunofluorescent analysis of PFA-fixed,Triton X-100 permeabilized U-2 OS cells labeling Reticulocalbin 3 with ab204178 at 4 µg/ml (green).
Protocols
Datasheets and documents
References
ab204178 has not yet been referenced specifically in any publications.
