Anti-Reticulocalbin 3 antibody (ab204178)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to Reticulocalbin 3
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-Reticulocalbin 3 antibody

  • Description

    Rabbit polyclonal to Reticulocalbin 3

  • Host species

    Rabbit

  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow

  • Immunogen

    Recombinant fragment corresponding to Human Reticulocalbin 3 aa 196-255.
    Sequence:

    EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTE RQQFRDFRDL


    Database link: Q96D15

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human cerebral cortex, upper gastrointestinal tract, testis, and skin tissues; ICC: U-2 OS cells; WB: AN3-CA cell lysate.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.25 - 2 µg/ml.
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 37 kDa.

Target

Images

  • Immunohistochemistry (Floating vibratome sections) - Anti-Reticulocalbin 3 antibody (ab204178)
    Immunohistochemistry (Floating vibratome sections) - Anti-Reticulocalbin 3 antibody (ab204178)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human upper gastrointestinal tract tissue labelling Reticulocalbin 3 with ab204178 at 1/2500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Western blot - Anti-Reticulocalbin 3 antibody (ab204178)
    Western blot - Anti-Reticulocalbin 3 antibody (ab204178)
    Anti-Reticulocalbin 3 antibody (ab204178) at 0.4 µg/ml + AN3-CA (human endometrium adenocarcinoma cell line) cell lysate

    Predicted band size: 37 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Reticulocalbin 3 antibody (ab204178)
    Immunocytochemistry/ Immunofluorescence - Anti-Reticulocalbin 3 antibody (ab204178)

    Immunofluorescent analysis of PFA-fixed,Triton X-100 permeabilized U-2 OS cells labeling Reticulocalbin 3 with ab204178 at 4 µg/ml (green).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling Reticulocalbin 3 with ab204178 at 1/2500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skin tissue labelling Reticulocalbin 3 with ab204178 at 1/2500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Reticulocalbin 3 antibody (ab204178)

    Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling Reticulocalbin 3 with ab204178 at 1/2500 dilution.

References (0)

Publishing research using ab204178? Please let us know so that we can cite the reference in this datasheet.

ab204178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab204178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com