Overview

  • Product name

  • Description

    Rabbit polyclonal to Reticulon 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human Reticulon 1 aa 193-281.
    Sequence:

    AYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKP APVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPV


    Database link: Q16799

  • Positive control

    • U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
  • Tissue specificity

    Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation.
  • Sequence similarities

    Contains 1 reticulon domain.
  • Post-translational
    modifications

    Isoforms RTN1-A and RTN1-B are phosphorylated.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neuroendocrine specific protein antibody
    • Neuroendocrine-specific protein antibody
    • NSP antibody
    • Reticulon 1 antibody
    • Reticulon-1 antibody
    • RTN 1 antibody
    • RTN1 antibody
    • RTN1_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling Reticulon 1 with ab220282 at 4 µg/mL (green).

References

ab220282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up