Overview

  • Product name

    Anti-Retinoblastoma binding protein 6 antibody
    See all Retinoblastoma binding protein 6 primary antibodies
  • Description

    Rabbit polyclonal to Retinoblastoma binding protein 6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Retinoblastoma binding protein 6 aa 1-40 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLK


    Database link: Q7Z6E9

  • Positive control

    • Rat kidney and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab217283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    E3 ubiquitin-protein ligase which promotes ubiquitination of YBX1, leading to its degradation by the proteasome. May play a role as a scaffold protein to promote the assembly of the p53/TP53-MDM2 complex, resulting in increase of MDM2-mediated ubiquitination and degradation of p53/TP53; may function as negative regulator of p53/TP53, leading to both apoptosis and cell growth.
  • Tissue specificity

    Highly expressed in the placenta and testis. Expressed at lower levels in the brain, heart, kidney, liver and lung. Overexpressed in esophageal cancer.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 CCHC-type zinc finger.
    Contains 1 DWNN domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylated by NEK6.
  • Cellular localization

    Nucleus > nucleolus. Chromosome. Cytoplasm > cytoskeleton > centrosome. Colocalizes with mitotic chromosomes. Co-localizes with NEK6 in the centrosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686P0638 antibody
    • DKFZp761B2423 antibody
    • E3 ubiquitin-protein ligase RBBP6 antibody
    • MY038 antibody
    • P2P R antibody
    • P2PR antibody
    • p53 associated cellular protein of testis antibody
    • p53-associated cellular protein of testis antibody
    • p53-associated cellular protein, testis-derived antibody
    • PACT antibody
    • Proliferation potential related protein antibody
    • Proliferation potential-related protein antibody
    • Protein P2P R antibody
    • Protein P2P-R antibody
    • Protein P2PR antibody
    • Protein RBQ 1 antibody
    • Protein RBQ1 antibody
    • RB binding protein 6, ubiquitin ligase antibody
    • RB binding Q protein 1 antibody
    • RBBP 6 antibody
    • Rbbp6 antibody
    • RBBP6_HUMAN antibody
    • RBQ 1 antibody
    • RBQ-1 antibody
    • RBQ1 antibody
    • Retinoblastoma binding protein 6 isoform 3 antibody
    • Retinoblastoma binding Q protein 1 antibody
    • Retinoblastoma-binding protein 6 antibody
    • Retinoblastoma-binding Q protein 1 antibody
    • SNAMA antibody
    • SNAMA, Drosophila, homolog of antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat testis tissue labeling Retinoblastoma binding protein 6 with ab217283 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat kidney tissue labeling Retinoblastoma binding protein 6 with ab217283 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up