Overview

  • Product name

    Anti-Retinoic Acid Receptor alpha antibody [H1920]
    See all Retinoic Acid Receptor alpha primary antibodies
  • Description

    Mouse monoclonal [H1920] to Retinoic Acid Receptor alpha
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ELISA, IP, ChIP, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Recombinant fragment:

    MASNSSSCPTPGGGHLNGYPVPPYAFFFPP

    , corresponding to amino acids 1-30 of Human Retinoic Acid Receptor alpha

  • General notes

    This product was changed from ascites to tissue culture supernatant on 3rd April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab41934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 51 kDa.
ELISA Use at an assay dependent concentration.
IP Use at an assay dependent concentration.
ChIP Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone acetylation, chromatin condensation and transcriptional suppression. On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation. RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Has a role in the survival of early spermatocytes at the beginning prophase of meiosis. In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function (By similarity). Regulates expression of target genes in a ligand-dependent manner by recruiting chromatin complexes containing MLL5. Mediates retinoic acid-induced granulopoiesis.
  • Involvement in disease

    Note=Chromosomal aberrations involving RARA are commonly found in acute promyelocytic leukemia. Translocation t(11;17)(q32;q21) with ZBTB16/PLZF; translocation t(15;17)(q21;q21) with PML; translocation t(5;17)(q32;q11) with NPM. The PML-RARA oncoprotein requires both the PML ring structure and coiled-coil domain for both interaction with UBE2I, nuclear microspeckle location and sumoylation. In addition, the coiled-coil domain functions in blocking RA-mediated transactivation and cell differentiation.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues. Phosphorylation does not change during cell cycle. Phosphorylation on Ser-77 is crucial for transcriptional activity (By similarity). Phosphorylation by AKT1 is required for the repressor activity but has no effect on DNA binding, protein stability nor subcellular localization. Phosporylated by PKA in vitro. This phosphorylation on Ser-219 and Ser-369 is critical for ligand binding, nuclear localization and transcriptional activity in response to FSH signaling.
    Sumoylated by SUMO2, mainly on Lys-399 which is also required for SENP6 binding. On all-trans retinoic acid (ATRA) binding, a confromational change may occur that allows sumoylation on two additional site, Lys-166 and Lys-171. Probably desumoylated by SENP6. Sumoylation levels determine nuclear localization and regulate ATRA-mediated transcriptional activity.
    Trimethylation enhances heterodimerization with RXRA and positively modulates the transcriptional activation.
    Ubiquitinated.
  • Cellular localization

    Nucleus. Cytoplasm. Nuclear localization depends on ligand binding, phosphorylation and sumoylation. Transloaction to the nucleus in the absence of ligand is dependent on activation of PKC and the downstream MAPK phosphorylation.
  • Information by UniProt
  • Database links

  • Alternative names

    • NR1B1 antibody
    • Nuclear mitotic apparatus protein retinoic acid receptor alpha fusion protein antibody
    • Nuclear receptor subfamily 1 group B member 1 antibody
    • Nucleophosmin retinoic acid receptor alpha fusion protein NPM RAR long form antibody
    • RAR alpha antibody
    • RAR antibody
    • RAR-alpha antibody
    • rara antibody
    • RARA_HUMAN antibody
    • RARalpha antibody
    • RARalpha1 antibody
    • Retinoic acid nuclear receptor alpha variant 1 antibody
    • Retinoic acid nuclear receptor alpha variant 2 antibody
    • Retinoic acid receptor alpha antibody
    • Retinoic acid receptor alpha polypeptide antibody
    see all

Images

  • Overlay histogram showing MCF7 cells stained with ab41934 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41934, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:

  • Yuan S  et al. SREBP-dependent lipidomic reprogramming as a broad-spectrum antiviral target. Nat Commun 10:120 (2019). Read more (PubMed: 30631056) »
  • Rotolo A  et al. Enhanced Anti-lymphoma Activity of CAR19-iNKT Cells Underpinned by Dual CD19 and CD1d Targeting. Cancer Cell 34:596-610.e11 (2018). Read more (PubMed: 30300581) »
See all 12 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-2 of 2 Abreviews

Application
Western blot
Sample
Mouse Tissue lysate - whole (Spleen, Liver, Small intestine and Colon)
Gel Running Conditions
Reduced Denaturing
Loading amount
50 µg
Specification
Spleen, Liver, Small intestine and Colon
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 28°C

Abcam user community

Verified customer

Submitted Sep 14 2018

Application
ChIP
Sample
Mouse Cell lysate - nuclear (myoblast)
Negative control
IgG
Specification
myoblast
Detection step
Semiquantitative PCR
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: 1% formaldehyde

Abcam user community

Verified customer

Submitted Jun 28 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up