For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    retinoic-acid-receptor-alpha-antibody-h1920-ab41934.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger
Share by email

Anti-Retinoic Acid Receptor alpha antibody [H1920] (ab41934)

  • Datasheet
  • SDS
Reviews (2) Submit a question References (16)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Flow Cytometry - Anti-Retinoic Acid Receptor alpha antibody [H1920] (ab41934)

    Key features and details

    • Mouse monoclonal [H1920] to Retinoic Acid Receptor alpha
    • Suitable for: Flow Cyt
    • Reacts with: Human
    • Isotype: IgG1

    You may also be interested in

    Primary
    Product image
    Anti-Retinoid X Receptor alpha/RXRA antibody [EPR7106] (ab125001)
    Assay
    Product image
    Flavin Adenine Dinucleotide (FAD) Assay Kit (ab204710)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-Retinoic Acid Receptor alpha antibody [H1920]
      See all Retinoic Acid Receptor alpha primary antibodies
    • Description

      Mouse monoclonal [H1920] to Retinoic Acid Receptor alpha
    • Host species

      Mouse
    • Tested applications

      Suitable for: Flow Cytmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Dog
    • Immunogen

      Recombinant fragment:

      MASNSSSCPTPGGGHLNGYPVPPYAFFFPP

      , corresponding to amino acids 1-30 of Human Retinoic Acid Receptor alpha
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • General notes

      This product was changed from ascites to tissue culture supernatant on 3rd April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

      If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7
      Preservative: 0.1% Sodium azide

      Physiological saline.
    • Concentration information loading...
    • Purity

      Tissue culture supernatant
    • Clonality

      Monoclonal
    • Clone number

      H1920
    • Isotype

      IgG1
    • Research areas

      • Epigenetics and Nuclear Signaling
      • Transcription
      • Domain Families
      • Zinc Finger
      • Signal Transduction
      • Signaling Pathway
      • Nuclear Signaling
      • Nuclear Hormone Receptors
      • Retinoic & Retinoid
      • Epigenetics and Nuclear Signaling
      • Nuclear Signaling Pathways
      • Nuclear Receptors
      • Retinoic & Retinoid
      • Cancer
      • Signal transduction
      • Nuclear signaling
      • Nuclear hormone receptors
      • Retanoic and retanoid
      • Neuroscience
      • Processes

    Associated products

    • ChIP Related Products

      • ChIP Kit (ab500)
    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
      • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
    • Isotype control

      • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
      • Mouse IgG1, Kappa Monoclonal [B11/6] - Isotype Control (ab91353)
    • Recombinant Protein

      • Recombinant Human Retinoic Acid Receptor alpha protein (ab82196)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab41934 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    Flow Cyt
    Use at an assay dependent concentration.

    ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

     

    Notes
    Flow Cyt
    Use at an assay dependent concentration.

    ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

     

    Target

    • Function

      Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone acetylation, chromatin condensation and transcriptional suppression. On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation. RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Has a role in the survival of early spermatocytes at the beginning prophase of meiosis. In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function (By similarity). Regulates expression of target genes in a ligand-dependent manner by recruiting chromatin complexes containing MLL5. Mediates retinoic acid-induced granulopoiesis.
    • Involvement in disease

      Note=Chromosomal aberrations involving RARA are commonly found in acute promyelocytic leukemia. Translocation t(11;17)(q32;q21) with ZBTB16/PLZF; translocation t(15;17)(q21;q21) with PML; translocation t(5;17)(q32;q11) with NPM. The PML-RARA oncoprotein requires both the PML ring structure and coiled-coil domain for both interaction with UBE2I, nuclear microspeckle location and sumoylation. In addition, the coiled-coil domain functions in blocking RA-mediated transactivation and cell differentiation.
    • Sequence similarities

      Belongs to the nuclear hormone receptor family. NR1 subfamily.
      Contains 1 nuclear receptor DNA-binding domain.
    • Domain

      Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
    • Post-translational
      modifications

      Phosphorylated on serine and threonine residues. Phosphorylation does not change during cell cycle. Phosphorylation on Ser-77 is crucial for transcriptional activity (By similarity). Phosphorylation by AKT1 is required for the repressor activity but has no effect on DNA binding, protein stability nor subcellular localization. Phosporylated by PKA in vitro. This phosphorylation on Ser-219 and Ser-369 is critical for ligand binding, nuclear localization and transcriptional activity in response to FSH signaling.
      Sumoylated by SUMO2, mainly on Lys-399 which is also required for SENP6 binding. On all-trans retinoic acid (ATRA) binding, a confromational change may occur that allows sumoylation on two additional site, Lys-166 and Lys-171. Probably desumoylated by SENP6. Sumoylation levels determine nuclear localization and regulate ATRA-mediated transcriptional activity.
      Trimethylation enhances heterodimerization with RXRA and positively modulates the transcriptional activation.
      Ubiquitinated.
    • Cellular localization

      Nucleus. Cytoplasm. Nuclear localization depends on ligand binding, phosphorylation and sumoylation. Transloaction to the nucleus in the absence of ligand is dependent on activation of PKC and the downstream MAPK phosphorylation.
    • Target information above from: UniProt accession P10276 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 480526 Dog
      • Entrez Gene: 5914 Human
      • Entrez Gene: 19401 Mouse
      • Omim: 180240 Human
      • SwissProt: Q5FBR4 Dog
      • SwissProt: P10276 Human
      • SwissProt: P11416 Mouse
      • Unigene: 654583 Human
      • Unigene: 439744 Mouse
      see all
    • Alternative names

      • NR1B1 antibody
      • Nuclear mitotic apparatus protein retinoic acid receptor alpha fusion protein antibody
      • Nuclear receptor subfamily 1 group B member 1 antibody
      • Nucleophosmin retinoic acid receptor alpha fusion protein NPM RAR long form antibody
      • RAR alpha antibody
      • RAR antibody
      • RAR-alpha antibody
      • rara antibody
      • RARA_HUMAN antibody
      • RARalpha antibody
      • RARalpha1 antibody
      • Retinoic acid nuclear receptor alpha variant 1 antibody
      • Retinoic acid nuclear receptor alpha variant 2 antibody
      • Retinoic acid receptor alpha antibody
      • Retinoic acid receptor alpha polypeptide antibody
      see all

    Images

    • Flow Cytometry - Anti-Retinoic Acid Receptor alpha antibody [H1920] (ab41934)
      Flow Cytometry - Anti-Retinoic Acid Receptor alpha antibody [H1920] (ab41934)

      Overlay histogram showing MCF7 cells stained with ab41934 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41934, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed.

      This image was generated using the ascites version of the product.

    Protocols

    • Flow cytometry protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (16)

    Publishing research using ab41934? Please let us know so that we can cite the reference in this datasheet.

    ab41934 has been referenced in 16 publications.

    • Zou G  et al. Herb-sourced emodin inhibits angiogenesis of breast cancer by targeting VEGFA transcription. Theranostics 10:6839-6853 (2020). PubMed: 32550907
    • Miao S  et al. Retinoic acid promotes metabolic maturation of human Embryonic Stem Cell-derived Cardiomyocytes. Theranostics 10:9686-9701 (2020). PubMed: 32863954
    • Paukovcekova S  et al. Enhanced Antiproliferative Effect of Combined Treatment with Calcitriol and All-Trans Retinoic Acid in Relation to Vitamin D Receptor and Retinoic Acid Receptor a Expression in Osteosarcoma Cell Lines. Int J Mol Sci 21:N/A (2020). PubMed: 32916897
    • Yuan S  et al. SREBP-dependent lipidomic reprogramming as a broad-spectrum antiviral target. Nat Commun 10:120 (2019). PubMed: 30631056
    • Cai W  et al. All trans-retinoic acid protects against acute ischemic stroke by modulating neutrophil functions through STAT1 signaling. J Neuroinflammation 16:175 (2019). PubMed: 31472680
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review

    Filter by Application

    Filter by Species

    Filter by Ratings

    1-2 of 2 Abreviews

    Western blot abreview for Anti-Retinoic Acid Receptor alpha antibody [H1920]

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (Spleen, Liver, Small intestine and Colon)
    Gel Running Conditions
    Reduced Denaturing
    Loading amount
    50 µg
    Specification
    Spleen, Liver, Small intestine and Colon
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 28°C
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Sep 14 2018

    ChIP abreview for Anti-Retinoic Acid Receptor alpha antibody [H1920]

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    ChIP
    Sample
    Mouse Cell lysate - nuclear (myoblast)
    Negative control
    IgG
    Specification
    myoblast
    Detection step
    Semiquantitative PCR
    Type
    Cross-linking (X-ChIP)
    Duration of cross-linking step: 10 minute(s) and 0 second(s)
    Specification of the cross-linking agent: 1% formaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Jun 28 2017

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.