Overview

  • Product name

    Anti-Retinoic Acid Receptor gamma 2 antibody - N-terminal
    See all Retinoic Acid Receptor gamma 2 primary antibodies
  • Description

    Rabbit polyclonal to Retinoic Acid Receptor gamma 2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Retinoic Acid Receptor gamma 2 aa 1-65 (N terminal).
    Sequence:

    MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLG QPDLPKEMASLSVET


    Database link: P13631

  • Positive control

    • Purkinje cells, PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab188000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB Use at an assay dependent concentration. Predicted molecular weight: 50 kDa.

Target

  • Function

    Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NR1B3 antibody
    • Nuclear receptor subfamily 1 group B member 3 antibody
    • RAR gamma antibody
    • RAR gamma isoform 2 antibody
    • RAR gamma2 antibody
    • RAR-gamma antibody
    • RARC antibody
    • Rarg antibody
    • RARG_HUMAN antibody
    • retinoic acid nuclear receptor gamma variant 1 antibody
    • retinoic acid nuclear receptor gamma variant 2 antibody
    • Retinoic acid receptor gamma antibody
    see all

Images

  • Anti-Retinoic Acid Receptor gamma 2 antibody - N-terminal (ab188000) + MCF7

    Secondary
    Retinoic Acid Receptor gamma 2

    Predicted band size: 50 kDa
    Observed band size: 55 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of paraffin-embedded Purkinje cells, labeling Retinoic Acid Receptor gamma 2 with ab188000 at 1/50 dilution.

  • Immunofluorescent analysis of PFA-fixed/Triton X-100-permeabilized Human cell line PC-3, labeling Retinoic Acid Receptor gamma 2 with ab188000 at 4 µg/ml.

  • All lanes : Anti-Retinoic Acid Receptor gamma 2 antibody - N-terminal (ab188000)

    Lane 1 : HEK293T cell lysate transfected with vector only
    Lane 2 : HEK293T cell lysate transfected with Retinoic Acid Receptor gamma 2 (co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 50 kDa

References

ab188000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up